Mollisia scopiformis: LY89DRAFT_679993 Help Entry LY89DRAFT_679993  CDS       T04865                                  Name (RefSeq) uncharacterized protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism psco  Mollisia scopiformis Pathway psco00510   N-Glycan biosynthesis psco00513   Various types of N-glycan biosynthesis psco01100   Metabolic pathways psco04141   Protein processing in endoplasmic reticulum Module psco_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:psco00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     LY89DRAFT_679993    00513 Various types of N-glycan biosynthesis     LY89DRAFT_679993  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     LY89DRAFT_679993 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost4 bCoV_NS7B Hpf1_C Motif Other DBs NCBI-GeneID:  28823713 NCBI-ProteinID:  XP_018077558 JGI:  679993 UniProt:  A0A194XSM9 LinkDB All DBs Position Unknown AA seq 58 aa AA seqDB search MISDDELYRLAIFLGSIAMLLIILYHFLEINSVEEPATDSKGKVTTGQAEVKAASIGR NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgatatccgacgacgaactctaccgactagcaatcttcctcggctcaattgctatgctc ctcattattctctaccacttcctcgagatcaactctgttgaagagccagcgacggacagc aagggcaaggtcactacaggtcaagcagaagtcaaagcagcatcaataggcagatga

DBGET integrated database retrieval system