KEGG   Pseudoxanthomonas spadix: DSC_02185
Entry
DSC_02185         CDS       T01643                                 
Name
(GenBank) carbamoyl-phosphate synthase L chain ATP-binding protein
  KO
K01968  3-methylcrotonyl-CoA carboxylase alpha subunit [EC:6.4.1.4]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00280  Valine, leucine and isoleucine degradation
psd01100  Metabolic pathways
Module
psd_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DSC_02185
Enzymes [BR:psd01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     DSC_02185
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl BT_MCC_alpha ATP-grasp Dala_Dala_lig_C GARS_A HlyD_3 Biotin_lipoyl_2 ATPgrasp_ST LAL_C2 ATP-grasp_3 ATP-grasp_5 ATP-grasp_4 SIS
Other DBs
NCBI-ProteinID: AER55090
UniProt: G7UV11
LinkDB
Position
complement(258667..260643)
AA seq 658 aa
MFEKILIANRGEIACRIIATCRRLGIATVAVYSDADAHARHVRLADEAWRLGPAPAVDSY
LKAEAILEIAARSGAQAIHPGYGFLSENAGFAAACQAAGIVFIGPPVGAIQAMGSKSQAK
AIMQRAGVPLVPGYHGADQDPAQLQAQAEAIGYPVLIKASAGGGGKGMRVVTQAGDFAAA
LASCKRESAASFGDDTVLLERYLQQPRHIEVQVFADASGQVIHLNERDCSSQRRHQKVVE
EAPAPGMTAARRAQMGQVACDAARAVGYVGAGTVEFIVGQDGAFYFMEMNTRLQVEHPVT
ELVTGLDLVEWQLRIAAGQPLPLTQEAVALDGHAIEARLYAEDPAAGFLPSIGTLSVFVA
PRQQEHQVRLDTGVEQGDQISPYYDPMIAKLIVHGPSRPQAIARMQRALAELRIVGVASN
VEFLQRLVGHPAFVAGQVDTGLIERESAALLPAAAAPPQDALHAAAIWTVLAEAPDASRP
PSPWDLGDGWRLNGSARRTLGFVHPAGTREIALEYQGAQAWSLDGQPVRLVQPPQAGRLQ
LDIAGHVLTAEVFAQGQDLHVFTAQGHTRLKPQRPLTPPEDAQDHQAGLLAPMPGRIITL
LVQPGATVEQGTPLLVMEAMKMEYTLSAPFKGIVLAFLHDEGAQVQAGMELIDFQAAP
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgttcgaaaagatcctcatcgccaaccgtggcgagatcgcctgcaggatcatcgccacc
tgccggcgcctgggcatcgccaccgtggcggtgtactcggatgccgatgcgcacgcacgc
cacgtgcgcctggccgatgaagcctggcggctgggcccggcgccggcggtggacagctat
ctcaaggccgaggcgatcctggagatcgccgcccgcagcggtgcccaggccatccacccc
ggctatggcttcctctcggagaacgcaggctttgctgcggcctgccaggccgccggcatc
gtcttcatcggccccccggtgggcgcgatccaggccatggggtccaagtcccaggccaag
gccatcatgcagcgcgccggcgtgcccttggtgcccggctaccacggcgccgaccaggac
ccggcgcagctgcaggcccaggccgaggcgattggttatccggtgctgatcaaggcctcg
gccggtggcggcggcaagggcatgcgcgtagtgacccaggccggcgactttgccgcggcg
ctggcctcgtgcaagcgcgaatcggccgccagcttcggcgatgacaccgtgctgctcgag
cgatacctgcagcaaccgcgccatatcgaagtccaggtgttcgccgacgccagcggccag
gtgatccatctcaacgagcgcgattgctcgtcccagcgccgccaccagaaggtggtcgag
gaagcgcccgcgcccggcatgaccgccgccaggcgcgcgcagatgggccaggtggcctgc
gacgcggcgcgggcggtgggttacgtgggcgccggcacggtggagttcatcgtcggccag
gacggcgcgttctacttcatggaaatgaacacccgcttgcaggtggagcatccggtcacc
gagctggtcaccggcctggacctggtggaatggcagctgcgcattgccgccggccagccg
ctgccgctgacgcaggaggcggtcgcactggacggccatgcgatcgaggccaggctgtat
gccgaagacccggctgccggcttcctgccttcgatcggcaccctgtcggtgttcgtcgcg
ccgcgccagcaggagcatcaggtgcgcctggataccggcgtcgaacagggtgaccagatc
agcccgtactacgacccgatgatcgccaagctgatcgtccatggcccatcgcggccgcag
gccatcgcccgcatgcagcgcgcgctggccgagctgcgcatcgtgggggtggccagcaac
gtcgagttcctgcagcggctggtggggcatccggcgttcgtcgccggccaggtggacacc
ggcctgatcgaacgcgaaagcgccgcgctgctgcccgccgccgccgcgccgccgcaggac
gcgctgcatgccgccgcgatctggaccgtgctggccgaagcgcccgatgccagccggccg
ccctcgccgtgggacctgggcgatggctggcgcctcaacggcagcgcccggcgcacgctc
ggcttcgtccatcccgccggcacgcgggagatcgcgctcgagtatcaaggcgcgcaggca
tggagcctggatggacagccggtgcgcctggtccagccgccgcaggcgggacggctgcag
ctggacatcgccggccacgtgctgacggccgaagtgttcgcgcaaggccaggacctgcat
gtgttcaccgcccagggccacacccggctcaagccgcagcggccgctgaccccgcccgag
gatgcgcaagatcaccaggccggcctgctggcgccgatgcccgggcggatcattacgctg
ctggtgcaacccggcgcgaccgtggagcagggcacaccgctgctggtgatggaggcgatg
aagatggagtacaccctgagcgcgccgttcaaggggatcgtcctggccttcctgcacgac
gagggcgcgcaggtccaggccgggatggagctgatcgatttccaggccgcgccatga

DBGET integrated database retrieval system