Pseudoxanthomonas spadix: DSC_13555 Help Entry DSC_13555         CDS       T01643                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism psd  Pseudoxanthomonas spadix Brite KEGG Orthology (KO) [BR:psd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psd03036]     DSC_13555 Chromosome and associated proteins [BR:psd03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     DSC_13555 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ZapB bZIP_1 RIMB1_N CCDC122 GAS FAZ1_C ZapB_rel TSC22 Rab11-FIP3 Taxilin Plectin_PPL DUF2381 CC_Bre1 SKA2 YabA DUF7491 CBP110 bZIP_2 SPC25_N Harakiri Spc24 Motif Other DBs NCBI-ProteinID:  AER57355 UniProt:  G7UTA9 LinkDB All DBs Position 2755932..2756150 Genome browser AA seq 72 aa AA seqDB search MDPSSIEQLRALAARLQELGDRCQRLSEENRSLRVQQEQLASERSQLLAKNELARSRVEA MITRLRSLEQHT NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggacccgtcctcgatcgaacagctacgcgccctggccgcacgcctgcaggaactgggc gatcgctgccaacggctgtccgaggagaaccgcagcctgcgcgtgcagcaggaacagctg gccagcgagcgctcgcagctgctggccaagaacgaactggcccgctcgcgcgtggaagcc atgatcacccgactgcgctcgctggagcagcacacgtga

DBGET integrated database retrieval system