Pseudonocardia sp. DSM 110487: K1T35_37465 Help Entry K1T35_37465       CDS       T10356                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism psds  Pseudonocardia sp. DSM 110487 Pathway psds00253   Tetracycline biosynthesis psds01056   Biosynthesis of type II polyketide backbone psds01100   Metabolic pathways psds01110   Biosynthesis of secondary metabolites Module psds_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite Lipid biosynthesis proteins [BR:psds01004]  Polyketide synthase   Component type    K1T35_37465 Polyketide biosynthesis proteins [BR:psds01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      K1T35_37465     Nonaketide PKS      K1T35_37465     Decaketide PKS      K1T35_37465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QYN34078 LinkDB All DBs Position 8006126..8006359 Genome browser AA seq 77 aa AA seqDB search MIMTIDDLRTILVACAGESDGPLDGDIRDVDFDELGYDSLALMETAARIRSDFGVTIPDE RIAELRTPREILDLVNG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgatcatgacgatcgacgacctccgcacgatcctcgtcgcctgcgcgggcgagtccgac ggcccgctcgacggtgacatccgcgacgtcgacttcgacgagctcggctacgactcactc gccctgatggagacggccgcacggatcaggagcgacttcggggtgaccatcccggacgag cggatcgccgagctgcgcacgccccgcgagatcctcgacctggtgaacggctga

DBGET integrated database retrieval system