Pseudogulbenkiania sp. NH8B: NH8B_2262 Help Entry NH8B_2262         CDS       T01619                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism pse  Pseudogulbenkiania sp. NH8B Pathway pse00998   Biosynthesis of various antibiotics pse01100   Metabolic pathways pse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pse00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NH8B_2262    00074 Mycolic acid biosynthesis     NH8B_2262   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NH8B_2262 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BAK77076 UniProt:  G2J4T1 LinkDB All DBs Position 2377870..2378154 Genome browser AA seq 94 aa AA seqDB search MDRARLRTLVIDSLRKIAPEVEESALRDNRPLRDEVDLDSMDWLNFIIGLHERLQVDIPE ADYRQLVSLDAVLDYLAARLRDAPTASPPRDSEP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggaccgcgcccgccttcgtaccctcgtgatcgactcgctgcgcaagattgccccggag gtggaggagagcgcgctgcgcgacaaccgccccttgcgcgacgaggtcgacctcgactcg atggattggctcaacttcatcatcggcctgcacgagcgccttcaggtcgacatccccgag gccgactatcgccagctggtctcgctcgacgccgtgctcgactacctcgcggcccggttg cgcgatgccccgaccgcctcaccgccccgtgacagcgagccctga

DBGET integrated database retrieval system