Pseudogulbenkiania sp. NH8B: NH8B_2429 Help Entry NH8B_2429         CDS       T01619                                  Name (GenBank) histidine triad (HIT) protein   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism pse  Pseudogulbenkiania sp. NH8B Brite KEGG Orthology (KO) [BR:pse00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:pse03016]     NH8B_2429   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pse04147]     NH8B_2429 Transfer RNA biogenesis [BR:pse03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     NH8B_2429 Exosome [BR:pse04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NH8B_2429 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HIT Motif Other DBs NCBI-ProteinID:  BAK77243 UniProt:  G2J598 LinkDB All DBs Position 2546167..2546409 Genome browser AA seq 80 aa AA seqDB search MLSATAAFAVRIAQRPPGIILVQANGSAADQTVPHFHIHLIPKYSGEFLVPLAARREDTE KLKGRAKRIIAAWPELKESN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctgtccgctacggccgccttcgcggtcaggatcgcccagaggccgcctggcattatc ctggtgcaggctaacggcagcgcggccgaccagaccgtgccgcactttcatatccacctg attccgaaatacagcggggagttccttgttccgcttgcagcacggagggaagacacggaa aagctgaaggggcgcgccaaacgaatcattgccgcctggcccgagctcaaggagagcaat tga

DBGET integrated database retrieval system