Pseudogulbenkiania sp. NH8B: NH8B_3536 Help Entry NH8B_3536         CDS       T01619                                  Symbol groES Name (GenBank) co-chaperonin GroES   KO K04078   chaperonin GroES Organism pse  Pseudogulbenkiania sp. NH8B Brite KEGG Orthology (KO) [BR:pse00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pse03110]     NH8B_3536 (groES)    03029 Mitochondrial biogenesis [BR:pse03029]     NH8B_3536 (groES) Chaperones and folding catalysts [BR:pse03110]  Heat shock proteins   HSP10    NH8B_3536 (groES) Mitochondrial biogenesis [BR:pse03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     NH8B_3536 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 ExoX-like_C Motif Other DBs NCBI-ProteinID:  BAK78287 LinkDB All DBs Position complement(3707310..3707597) Genome browser AA seq 95 aa AA seqDB search MAIRPLHDRVVIKRLEAEEKTASGIVLPGAAAEKPDMGEVIAVGNGKILENGERRPLELK VGDKVIFGKYSGQTVKVDGDEVLVMREEDVMGIVE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcaattcgtcctttgcacgaccgtgttgtaatcaagcgcctcgaggcggaagaaaag acggcttccggtatcgttctgccgggtgcggctgccgagaagccggacatgggcgaagtg atcgccgtgggcaacggcaagattctggaaaacggcgagcgccgtccgctggagctgaag gtcggcgacaaagtgatcttcggcaagtactccggccagaccgtcaaggtcgatggcgat gaagtcctcgtgatgcgcgaggaagacgttatgggcatcgttgagtaa

DBGET integrated database retrieval system