Pseudorhodobacter turbinis: EOK75_00885 Help Entry EOK75_00885       CDS       T05954                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pseb  Pseudorhodobacter turbinis Pathway pseb01100   Metabolic pathways pseb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pseb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EOK75_00885    00074 Mycolic acid biosynthesis     EOK75_00885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EOK75_00885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QCO54503 UniProt:  A0A4P8ECX2 LinkDB All DBs Position 213478..213711 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVVENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISSAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgctgaccgcgttaagaagatcgtcgtcgagcatctgggcgtcgaagaa gacaaggtcgttgaaaacgcctcgtttattgacgatctgggcgcggacagccttgatacc gtagagctggttatggcgtttgaagaagagttcggaatcgaaattccggatgacgctgca gaaaccatccaaacctttggcgatgcggtaaagttcatctcaagcgcgtcttga

DBGET integrated database retrieval system