Pseudorhodobacter turbinis: EOK75_13050 Help Entry EOK75_13050       CDS       T05954                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pseb  Pseudorhodobacter turbinis Pathway pseb00190   Oxidative phosphorylation pseb01100   Metabolic pathways Module pseb_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pseb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     EOK75_13050  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pseb00194]     EOK75_13050 Photosynthesis proteins [BR:pseb00194]  Photosystem and electron transport system   F-type ATPase [OT]    EOK75_13050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QCO56742 UniProt:  A0A4P8EIS7 LinkDB All DBs Position unnamed1:144538..144774 Genome browser AA seq 78 aa AA seqDB search MEGELAQMGKYIGAGLAAFGLGGAGIGVGNIAGNFLAGALRNPSAAAGQTATLFVGIAFA EALGIFSFLIALLLMFAV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaggcgaactcgcacaaatgggtaagtacatcggagcaggccttgcagctttcggg cttggcggcgctggtatcggcgtgggcaacattgcagggaacttccttgcaggcgctctg cgtaacccttcggctgctgccggtcagactgcaacactgttcgtcggcatcgcattcgcc gaagcactgggcatcttctcgttcctgatcgccctgctgctgatgtttgcggtctga

DBGET integrated database retrieval system