Pseudorhodobacter turbinis: EOK75_14965 Help Entry EOK75_14965       CDS       T05954                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pseb  Pseudorhodobacter turbinis Pathway pseb01100   Metabolic pathways pseb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pseb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EOK75_14965    00074 Mycolic acid biosynthesis     EOK75_14965   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EOK75_14965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QCO57082 UniProt:  A0A4P8EJQ2 LinkDB All DBs Position unnamed1:complement(550266..550526) Genome browser AA seq 86 aa AA seqDB search MTIEQKIRGIIAEQAMLDVADVTPESTLESLGVDSLGLVEAIFAIEEAFDVSVPFNANAP EESGFDLTSVRTITAAVQALIDQQTS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacgattgagcaaaagatacgcggcattatcgccgagcaagcgatgctggacgtggcg gatgtaacgcctgaaagcacgcttgaaagcctcggggttgatagcctcgggctggtcgaa gcgatctttgcaatcgaggaggcctttgatgtctccgtccctttcaacgccaatgcaccg gaggagagcgggttcgacctgacttctgttcgtactatcacggcggcggtgcaggccttg atcgatcagcaaacatcgtga

DBGET integrated database retrieval system