Stutzerimonas frequens: DM292_05650 Help Entry DM292_05650       CDS       T05921                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psed  Stutzerimonas frequens Pathway psed01100   Metabolic pathways psed01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psed00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM292_05650    00074 Mycolic acid biosynthesis     DM292_05650   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM292_05650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AWT09734 LinkDB All DBs Position 1202688..1202924 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaacttggcgttaaagaa gaggaagtaaccaacagcgcttccttcgtcgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgagatcccggacgagcaggct gagaagatcaccaccgttcaggaagccatcgattacatcaacgcgcacgcgcagtaa

DBGET integrated database retrieval system