Stutzerimonas frequens: DM292_15780 Help Entry DM292_15780       CDS       T05921                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psed  Stutzerimonas frequens Pathway psed01100   Metabolic pathways psed01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psed00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM292_15780    00074 Mycolic acid biosynthesis     DM292_15780   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM292_15780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AWT11555 LinkDB All DBs Position 3358298..3358561 Genome browser AA seq 87 aa AA seqDB search MSQLTLEIKQLIIDALGLEDLGPDDIDADQPLFGEGLGLDSVDALELGLAIQKRFGIKID ADAKDTRKHFASVDSLAAFVSASRAIA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccaactgacgcttgaaatcaagcaactgatcatcgacgccctgggtctggaagac ctcggcccggacgacatcgacgccgaccagccgctgttcggcgaagggctcggcctggat tcggtggacgccttggaactgggtctggcgatccagaagcgcttcggcatcaagatcgac gccgacgccaaggacacccgcaagcatttcgccagcgtcgacagcctggcagccttcgtc agcgccagtcgcgccatcgcctga

DBGET integrated database retrieval system