Pseudonocardia sp. EC080625-04: FRP1_17940 Help Entry FRP1_17940        CDS       T04054                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psee  Pseudonocardia sp. EC080625-04 Pathway psee00998   Biosynthesis of various antibiotics psee01100   Metabolic pathways psee01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psee00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FRP1_17940    00074 Mycolic acid biosynthesis     FRP1_17940   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FRP1_17940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALE74397 LinkDB All DBs Position 3882975..3883217 Genome browser AA seq 80 aa AA seqDB search MADNAEILSGLAEIVEEVAGIDTAEVTPEKSFVDDLDIDSLSMVEIAVQAEDKFGAKIPD DQLAELKTVGDAVDFIAKHQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtggctgacaacgctgagatcctgtccgggctggccgagatcgtcgaggaggtcgccggc atcgacaccgccgaggtgaccccggagaagtccttcgtggacgacctggacatcgactcg ctgtccatggtggagatcgccgtccaggccgaggacaagttcggcgccaagatcccggac gaccagctggccgagctgaagaccgtcggcgacgccgtcgacttcatcgccaagcaccag tga

DBGET integrated database retrieval system