Pseudonocardia sp. HH130629-09: XF36_05995 Help Entry XF36_05995        CDS       T04082                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pseh  Pseudonocardia sp. HH130629-09 Pathway pseh00998   Biosynthesis of various antibiotics pseh01100   Metabolic pathways pseh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pseh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XF36_05995    00074 Mycolic acid biosynthesis     XF36_05995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XF36_05995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALE82765 UniProt:  A0A0M3UAM7 LinkDB All DBs Position complement(1335600..1335842) Genome browser AA seq 80 aa AA seqDB search MADNAEILTGLAEIVEEVAGIDTAEVTPEKSFVDDLDIDSLSMVEIAVQAEDKFGAKIPD DQLAELKTVGDAVDFIAKHQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtggctgacaacgccgagatcctcaccgggctggccgagatcgtcgaggaggtcgccggc atcgacaccgccgaggtgacccccgagaagtccttcgtggacgacctggacatcgactcg ctgtcgatggtggagatcgccgtgcaggccgaggacaagttcggcgccaagatcccggac gaccagctcgccgagctgaagaccgtcggcgacgccgtcgacttcatcgccaagcaccag tga

DBGET integrated database retrieval system