Pseudomonas sediminis: HNQ25_21580 Help Entry HNQ25_21580       CDS       T07154                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psej  Pseudomonas sediminis Pathway psej01100   Metabolic pathways psej01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psej00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HNQ25_21580    00074 Mycolic acid biosynthesis     HNQ25_21580   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HNQ25_21580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding B3R DUF1493 DUF7080 Motif Other DBs NCBI-ProteinID:  QNH00851 UniProt:  A0A7G7RDJ9 LinkDB All DBs Position 4614434..4614700 Genome browser AA seq 88 aa AA seqDB search MQSREEIFVTLRSALVELFELDAERVTLDASLYEDLEIDSIDAVDLIDHIKRQTGRKLAA EEFKSVRSVGDVVEAVYRLINDAPQTQD NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcaaagccgtgaagaaatcttcgtcaccctgcgtagcgccctggtggagttgttcgaa ctggatgccgagcgtgtgactctggacgccagcctgtatgaagacctggagatcgacagc atcgatgccgtcgacctgatcgaccacatcaagcgccagaccggccgcaagcttgccgcc gaagaattcaagagcgtgcgcagcgtcggcgatgtggtcgaggccgtctatcgcctgatc aacgacgcgcctcagactcaagactga

DBGET integrated database retrieval system