Paraoerskovia sediminicola: GCM125_02640 Help Entry GCM125_02640      CDS       T09128                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism psek  Paraoerskovia sediminicola Pathway psek03430   Mismatch repair Brite KEGG Orthology (KO) [BR:psek00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     GCM125_02640  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:psek03400]     GCM125_02640 Enzymes [BR:psek01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      GCM125_02640 DNA repair and recombination proteins [BR:psek03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      GCM125_02640 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Exonuc_VII_S TSKS TPR_16 Motif Other DBs NCBI-ProteinID:  BDZ40965 UniProt:  A0ABN6XB20 LinkDB All DBs Position 242990..243310 Genome browser AA seq 106 aa AA seqDB search MTQNSEGRQPSTGAAATDGPEIPADVAALGYEEAKDELIRIVAQLESGGAPLEASLALWE RGEALAAQCQRRLDGARERLDRATANGSEAPAAGASPADGADDDTD NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgacacagaactccgaaggtcggcagccgagcacgggcgccgcggccacggacggaccg gagatcccggcagacgtcgccgcgctcgggtacgaggaggcgaaggacgagttgatccgc atcgtcgcccagctcgagtccggcggcgccccgctcgaggcgtcgctcgccctctgggag cgtggcgaagcgctcgccgcgcagtgccagcgtcggctcgacggcgcccgggagcgtctc gaccgcgcgaccgctaacggcagcgaggcgcctgccgccggtgcgagcccggccgacggc gcggacgacgacaccgactga

DBGET integrated database retrieval system