Paraoerskovia sediminicola: GCM125_12530 Help Entry GCM125_12530      CDS       T09128                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism psek  Paraoerskovia sediminicola Pathway psek03060   Protein export psek03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:psek00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GCM125_12530  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GCM125_12530  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:psek02044]     GCM125_12530 Secretion system [BR:psek02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    GCM125_12530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E HxlR Motif Other DBs NCBI-ProteinID:  BDZ41954 LinkDB All DBs Position complement(1288111..1288335) Genome browser AA seq 74 aa AA seqDB search MNALKPWHMLVLLVVVLLLFGAKRLPDLARSVGQSMKIFKSEVKDLREDADVVVDAAGSA SRTAAQPSSESAQR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaacgccctgaagccatggcacatgctcgtgctgctcgtcgtcgtgctcctgctcttc ggagcgaagcgccttcccgacctggcgcgcagcgtgggccagtcgatgaagatcttcaag tccgaggtcaaggacctgcgtgaggacgcggacgtggtcgtcgacgcggcgggctccgcg agccggacggcagctcagccgtccagcgagtccgcgcagcggtga

DBGET integrated database retrieval system