Pseudodesulfovibrio cashew: GM415_17635 Help Entry GM415_17635       CDS       T06353                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism psel  Pseudodesulfovibrio cashew Pathway psel01100   Metabolic pathways psel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GM415_17635    00074 Mycolic acid biosynthesis     GM415_17635   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GM415_17635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Pallilysin Motif Other DBs NCBI-ProteinID:  QGY41865 UniProt:  A0A6I6JG96 LinkDB All DBs Position complement(3848353..3848589) Genome browser AA seq 78 aa AA seqDB search MSVTTADVLELFSTVVTPETLQGIDPDQPLLTQGVDSLALTSLAVALQREFSIELTIADA ITLRTVNDIVCFINSKVQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgtaaccaccgctgacgttctcgagctcttttccaccgttgtcacccctgaaaca ttgcaggggatagacccggaccagcccctgctgacccagggagtggactctctcgccctg acttccctggccgtggccctgcagcgcgagttctctatcgaattgaccatcgccgacgcc attaccctgcggaccgtcaatgacatcgtctgtttcatcaactcgaaggtgcagtag

DBGET integrated database retrieval system