Pseudomonas sp. MRSN12121: TO66_02330 Help Entry TO66_02330        CDS       T03702                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psem  Pseudomonas sp. MRSN12121 Pathway psem01100   Metabolic pathways psem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TO66_02330    00074 Mycolic acid biosynthesis     TO66_02330   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TO66_02330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GRIN_C Motif Other DBs NCBI-ProteinID:  AJO76179 UniProt:  A0A0C5DVS2 LinkDB All DBs Position complement(527361..527621) Genome browser AA seq 86 aa AA seqDB search MSDLHQEIKMLIIDALGLEDISVHDIGDEQTLFGEGLGLDSVDALELGLAIQKRYGIKID ADAKDTRNHFSNVASLAAFVIAKQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccaggaaattaaaatgttgatcatcgatgccctgggcctcgaagac atcagcgtgcacgacatcggcgacgagcagacgctgttcggtgaaggcctgggcctggac tcggtcgacgccctggaactgggcctggcgatccagaaacgctacggcatcaagatcgac gccgacgccaaggacacccgcaaccacttctccaacgtggcgagcctcgcggccttcgtc attgcaaaacaggcagcttga

DBGET integrated database retrieval system