Pseudoalteromonas piratica: OM33_19600 Help Entry OM33_19600        CDS       T03513                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pseo  Pseudoalteromonas piratica Pathway pseo01100   Metabolic pathways pseo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pseo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OM33_19600    00074 Mycolic acid biosynthesis     OM33_19600   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OM33_19600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding RST Motif Other DBs NCBI-ProteinID:  AIY67260 UniProt:  A0A0A7EKP0 LinkDB All DBs Position 2:complement(1094039..1094287) Genome browser AA seq 82 aa AA seqDB search MKTQQEIFAVLTDILVEEFEIDQDDVALEANLYQDLDLDSIDAVDLVVKLREITGKKIDP EAFKQVRTVEDVVNEVSKLVTE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaaaacacaacaagaaatcttcgcagttttaactgatatcttggtggaagaatttgaa attgatcaggatgatgttgctttagaagcaaacctatatcaagaccttgatctagatagc attgatgcggttgatttagtagtaaaattacgcgaaatcacgggtaagaaaatcgatcca gaagcgtttaaacaagtacgcacagtagaagatgtggtaaacgaagttagcaaactcgtt accgaatag

DBGET integrated database retrieval system