Pseudonocardia sp. EC080610-09: AD006_25385 Help Entry AD006_25385       CDS       T04146                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pseq  Pseudonocardia sp. EC080610-09 Pathway pseq00998   Biosynthesis of various antibiotics pseq01100   Metabolic pathways pseq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pseq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AD006_25385    00074 Mycolic acid biosynthesis     AD006_25385   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AD006_25385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALL77806 LinkDB All DBs Position 5520883..5521125 Genome browser AA seq 80 aa AA seqDB search MADNAEILSGLAEIVEEVAGIDTAEVTPEKSFVDDLDIDSLSMVEIAVQAEDKFGAKIPD DQLAELKTVGDAVDFIAKHQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtggctgacaacgctgagatcctgtccgggctggccgagatcgtcgaggaggtcgccggc atcgacaccgccgaggtgaccccggagaagtccttcgtggacgacctggacatcgactcg ctgtccatggtggagatcgccgtccaggccgaggacaagttcggcgccaagatcccggac gaccagctggccgagctgaagaccgtcggcgacgccgtcgacttcatcgccaagcaccag tga

DBGET integrated database retrieval system