Pseudanabaena sp. ABRG5-3: ABRG53_2487 Help Entry ABRG53_2487       CDS       T05820                                  Symbol atpH Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pser  Pseudanabaena sp. ABRG5-3 Pathway pser00190   Oxidative phosphorylation pser00195   Photosynthesis pser01100   Metabolic pathways Module pser_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pser00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ABRG53_2487 (atpH)    00195 Photosynthesis     ABRG53_2487 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pser00194]     ABRG53_2487 (atpH) Photosynthesis proteins [BR:pser00194]  Photosystem and electron transport system   F-type ATPase [OT]    ABRG53_2487 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  BBC24744 UniProt:  A0A2Z5WZB7 LinkDB All DBs Position 2780089..2780337 Genome browser AA seq 82 aa AA seqDB search MIDPLVASASVVAASIAVGLGAVGPGIGQGTAASRAVEGIARQPEAEGKIRGTLLLSFAF MEALTIYGLVIALILLFANPFA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgattgatccattagtagcatcagcttctgtagtcgccgctagtattgctgttggtctt ggcgcagttggacctggtatcggacaaggtactgctgctagccgcgctgttgaaggtatc gcacgtcaacctgaagcagaaggcaaaatccgtggtactttgcttttgagctttgcgttt atggaagctcttaccatttatggtctagttattgctctaatcttactttttgccaaccct tttgcctaa

DBGET integrated database retrieval system