Pseudanabaena sp. ABRG5-3: ABRG53_3206 Help Entry ABRG53_3206       CDS       T05820                                  Symbol psbF Name (GenBank) cytochrome b559 subunit beta   KO K02708   photosystem II cytochrome b559 subunit beta Organism pser  Pseudanabaena sp. ABRG5-3 Pathway pser00195   Photosynthesis pser01100   Metabolic pathways Module pser_M00161   Photosystem II pser_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:pser00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     ABRG53_3206 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pser00194]     ABRG53_3206 (psbF) Photosynthesis proteins [BR:pser00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     ABRG53_3206 (psbF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  BBC25463 UniProt:  A0A2Z5X1W3 LinkDB All DBs Position 3569403..3569537 Genome browser AA seq 44 aa AA seqDB search MASNNPNQPVQYPVFTFRWLAVHGLGVPTVFFIGAIAAMQFISR NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcaagcaacaatcctaaccaacccgttcaatatcctgtattcaccttccgttggcta gcagttcacggtttaggcgttcctaccgtgttttttattggcgcgatcgcagcaatgcaa ttcattagccgctag

DBGET integrated database retrieval system