Pseudomonas sp. StFLB209: PSCI_5592 Help Entry PSCI_5592         CDS       T03623                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pses  Pseudomonas sp. StFLB209 Pathway pses00998   Biosynthesis of various antibiotics pses01100   Metabolic pathways pses01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pses00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSCI_5592 (acpP)    00074 Mycolic acid biosynthesis     PSCI_5592 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSCI_5592 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 NirdL-like_HTH HLH Motif Other DBs NCBI-ProteinID:  BAP46294 LinkDB All DBs Position complement(6327657..6327893) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNSHQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaacttggcgtcaaagaa gaagaggttgtcaacactgcttctttcgttgaagacctgggcgctgactccctggacact gttgagctggtaatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcaccaccgttcaggctgccatcgactacgtgaacagccaccagggctga

DBGET integrated database retrieval system