Pseudomonas sp. TCU-HL1: THL1_5498 Help Entry THL1_5498         CDS       T05373                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pset  Pseudomonas sp. TCU-HL1 Brite KEGG Orthology (KO) [BR:pset00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pset03036]     THL1_5498 Chromosome and associated proteins [BR:pset03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     THL1_5498 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Asd-4 Matrilin_ccoil Motif Other DBs NCBI-ProteinID:  AOE88045 UniProt:  A0A1B3EEW4 LinkDB All DBs Position 5969978..5970187 Genome browser AA seq 69 aa AA seqDB search MEDAELHALTAKLELLIQRVEQLKAQNRLLLASEKAWREERAHLIEKNEMARLKVEAMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacgccgaactgcatgcactgacagccaagctggagctcctgatccagcgtgtc gagcagctcaaggcccagaaccggctcctgcttgccagcgagaaggcctggcgcgaagaa cgcgctcatctgatcgaaaagaacgaaatggcccggctcaaggtcgaagcgatgatttcg cgcctgaaagccctggagcaggattcatga

DBGET integrated database retrieval system