Thalassoporum mexicanum: Pse7367_0764 Help Entry Pse7367_0764      CDS       T02369                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pseu  Thalassoporum mexicanum Pathway pseu01100   Metabolic pathways pseu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pseu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pse7367_0764    00074 Mycolic acid biosynthesis     Pse7367_0764   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pse7367_0764 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AFY69065 UniProt:  K9SFZ3 LinkDB All DBs Position 979232..979474 Genome browser AA seq 80 aa AA seqDB search MSETLSKVQDIVADKLSVDAAEVKPEASFANDLGADSLDVVELVMALEEEFEVDIPDEDA EAIATVQDAVNYIEQKKAAV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaaccctttctaaagttcaagatatagtagcagacaagctcagcgttgatgcg gctgaagtcaaacctgaagcaagttttgccaatgatctaggagccgactccttggatgtt gtggaattggtaatggccttagaagaagaatttgaggttgacattcccgatgaggatgcc gaggcaattgctactgttcaggatgcggttaactatattgagcagaaaaaagctgccgta tag

DBGET integrated database retrieval system