Thalassoporum mexicanum: Pse7367_0905 Help Entry Pse7367_0905      CDS       T02369                                  Name (GenBank) Cytochrome b559 subunit alpha   KO K02707   photosystem II cytochrome b559 subunit alpha Organism pseu  Thalassoporum mexicanum Pathway pseu00195   Photosynthesis pseu01100   Metabolic pathways Module pseu_M00161   Photosystem II pseu_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:pseu00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     Pse7367_0905  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pseu00194]     Pse7367_0905 Photosynthesis proteins [BR:pseu00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     Pse7367_0905 SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 DUF8676 Motif Other DBs NCBI-ProteinID:  AFY69205 LinkDB All DBs Position 1173650..1173904 Genome browser AA seq 84 aa AA seqDB search MAGTTGERPFGDIITSVRYWIIHSLTIPALFIAGWLFVSTGLAYDVFGTPRPNEYYTLDR SDAPVLLDRFNAIDDIEDFNDSLN NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcaggtacaacgggtgaaagaccttttggtgacatcattaccagtgttcgttactgg attattcatagcttgacgattccggctttgtttattgctggttggctgtttgtcagtact ggtctggcctatgatgtttttggcacccccagaccaaacgaatactacaccctcgatcgc tccgatgcaccagtattgctggatcgctttaatgcgatcgatgatattgaagattttaat gactcgcttaattaa

DBGET integrated database retrieval system