Pseudoclavibacter triregionum: USB125703_01675 Help Entry USB125703_01675   CDS       T07344                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism psev  Pseudoclavibacter triregionum Pathway psev01100   Metabolic pathways psev01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psev00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     USB125703_01675 (acpP)    00074 Mycolic acid biosynthesis     USB125703_01675 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     USB125703_01675 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7127 Motif Other DBs NCBI-ProteinID:  CAG7845411 LinkDB All DBs Position 1:complement(1864242..1864490) Genome browser AA seq 82 aa AA seqDB search MALSKDEILAGLAELVNDETGIAADTVTMEKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVQNLKTVGDAVNYIEQAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactcagcaaggacgagatcctcgccggcctcgccgagctcgtcaacgacgagacc ggcatcgcggcggacaccgtgacgatggagaagtcgttcacggacgacctcgacatcgac tcgatctcgatgatgacgatcgtcgtcaacgccgaggagaagttcgacgtgaagatcccc gacgaggaggtccagaacctcaagacggtcggcgacgcggtcaactacatcgagcaggcg caggcctag

DBGET integrated database retrieval system