Paracoccus seriniphilus: JHW44_11955 Help Entry JHW44_11955       CDS       T08801                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psew  Paracoccus seriniphilus Pathway psew01100   Metabolic pathways psew01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psew00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JHW44_11955    00074 Mycolic acid biosynthesis     JHW44_11955   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JHW44_11955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WCR13619 LinkDB All DBs Position complement(2453078..2453311) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVDEDKVVEAASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTVGDAVSFIKGAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgatcgcgtgaagaaaatcgttgtcgagcatctgggcgtcgacgag gacaaggtggttgaggccgcttcgttcatcgacgatctgggcgcagacagcctcgacact gtcgaactggtcatggctttcgaggaagaattcgggatcgagatccccgatgacgccgcc gaaaccattcagaccgtcggtgatgcggtgagcttcatcaaaggggcggtctga

DBGET integrated database retrieval system