Polypterus senegalus (gray bichir): 120516565 Help Entry 120516565         CDS       T08668                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism psex  Polypterus senegalus (gray bichir) Pathway psex04020   Calcium signaling pathway psex04070   Phosphatidylinositol signaling system psex04114   Oocyte meiosis psex04218   Cellular senescence psex04261   Adrenergic signaling in cardiomyocytes psex04270   Vascular smooth muscle contraction psex04371   Apelin signaling pathway psex04625   C-type lectin receptor signaling pathway psex04744   Phototransduction psex04910   Insulin signaling pathway psex04912   GnRH signaling pathway psex04916   Melanogenesis Brite KEGG Orthology (KO) [BR:psex00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     120516565    04020 Calcium signaling pathway     120516565    04070 Phosphatidylinositol signaling system     120516565  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     120516565    04218 Cellular senescence     120516565  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120516565   09152 Endocrine system    04910 Insulin signaling pathway     120516565    04912 GnRH signaling pathway     120516565    04916 Melanogenesis     120516565   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     120516565    04270 Vascular smooth muscle contraction     120516565   09157 Sensory system    04744 Phototransduction     120516565  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:psex01009]     120516565   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psex04131]     120516565    03036 Chromosome and associated proteins [BR:psex03036]     120516565   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psex04147]     120516565 Protein phosphatases and associated proteins [BR:psex01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      120516565 Membrane trafficking [BR:psex04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     120516565 Chromosome and associated proteins [BR:psex03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      120516565 Exosome [BR:psex04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120516565 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C Dockerin_1 SPARC_Ca_bdg EF_EFCAB10_C SAPC2_N UPF0154 Caleosin EF-hand_EFHB_C SPM EF-hand_11 GIP1_N FCaBP_EF-hand SPEF2_C EFhand_Ca_insen YqeY DUF5580_M Motif Other DBs NCBI-GeneID:  120516565 NCBI-ProteinID:  XP_039594259 LinkDB All DBs Position 16:86505523..86505972 Genome browser AA seq 149 aa AA seqDB search MADQLPPEQIAEFREAFALFDKDGDGTITSKELGTVMRALGQNPSEAELQDMINEVDADS NGIVDFTEFLTLMVKRIKDMDSEEEIREAFKVFDKDGNGSISAEELHLVMKNLGEDLTDE EIYEMIREADIDGDGQINYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccagctgccccctgagcaaatagctgaattccgagaagcctttgctttattc gacaaggatggcgatggtaccattacttctaaagagctggggacagtcatgagagccttg ggccaaaacccatcagaggcagagctacaggacatgatcaatgaagtggacgcagatagc aatggcattgtagatttcaccgaattcctgaccttgatggtcaagaggattaaggacatg gacagtgaagaagaaatccgcgaggccttcaaggttttcgataaggatggcaatggatcc atcagtgctgaggaacttcacctggttatgaaaaaccttggggaggatctaacagatgaa gaaatatacgaaatgatcagagaagctgacattgatggtgacggccaaatcaattacgaa gagtttgttcagatgatgactgcaaagtga

DBGET integrated database retrieval system