Polypterus senegalus (gray bichir): 120516766 Help Entry 120516766         CDS       T08668                                  Name (RefSeq) mitoregulin-like   KO K29035   mitoregulin Organism psex  Polypterus senegalus (gray bichir) Brite KEGG Orthology (KO) [BR:psex00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:psex03029]     120516766 Mitochondrial biogenesis [BR:psex03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     120516766 SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom Motif Other DBs NCBI-GeneID:  120516766 NCBI-ProteinID:  XP_039594623 LinkDB All DBs Position 16:complement(90488337..90492957) Genome browser AA seq 56 aa AA seqDB search MADLLDRHVQVAVVVSFAVGFFAGWQANRMRRRFLDWRKKRLQDKLSETQKKLDLS NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggctgatctattagacagacacgtgcaagtcgctgttgtcgtctcctttgctgttggc ttctttgcgggatggcaagctaacagaatgagaagaaggtttctagactggaggaagaaa aggctgcaagacaaactatcagaaacgcaaaagaagctggatttatcgtaa

DBGET integrated database retrieval system