Polypterus senegalus (gray bichir): 120523258 Help Entry 120523258         CDS       T08668                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism psex  Polypterus senegalus (gray bichir) Pathway psex04010   MAPK signaling pathway psex04012   ErbB signaling pathway psex04068   FoxO signaling pathway psex04137   Mitophagy - animal psex04140   Autophagy - animal psex04144   Endocytosis psex04150   mTOR signaling pathway psex04210   Apoptosis psex04218   Cellular senescence psex04370   VEGF signaling pathway psex04371   Apelin signaling pathway psex04510   Focal adhesion psex04540   Gap junction psex04625   C-type lectin receptor signaling pathway psex04810   Regulation of actin cytoskeleton psex04910   Insulin signaling pathway psex04912   GnRH signaling pathway psex04916   Melanogenesis psex05132   Salmonella infection Brite KEGG Orthology (KO) [BR:psex00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     120523258    04150 mTOR signaling pathway     120523258  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120523258    04140 Autophagy - animal     120523258    04137 Mitophagy - animal     120523258  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psex04131]     120523258   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psex04147]     120523258    04031 GTP-binding proteins [BR:psex04031]     120523258 Membrane trafficking [BR:psex04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120523258  Endocytosis   Macropinocytosis    Ras GTPases     120523258 Exosome [BR:psex04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    120523258   Exosomal proteins of colorectal cancer cells    120523258 GTP-binding proteins [BR:psex04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120523258 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  120523258 NCBI-ProteinID:  XP_039600364 LinkDB All DBs Position 1:18035674..18165075 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CISCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagctggtggcgttgggaagagcgctttgacc atccagctgatacagaaccattttgtggacgaatacgacccaacgatagaggattcttat agaaaacaagtagtaatcgatggggagacgtgcttgttagacattttggacactgcgggt caagaggagtacagcgcaatgcgagatcagtacatgagaactggagagggcttcctgtgt gtctttgccatcaataacaccaaatcatttgaggacattcatcagtacagggaacaaata aaaagagtgaaagactcagacgacgttcccatggttcttgtgggaaacaaatgtgacctg ccggcgcggactgtggacacgagacaagctcaagagcttgcaaggagctacggcatcccg tatatagaaacctcagccaagaccagacagggagtagaggatgccttctacactttggtg cgggaaatccggcagcataaactccgaaagctgaaccctccagatgaaagcggacaggac tgcatcagctgtaaatgtgtcatttcgtga

DBGET integrated database retrieval system