Polypterus senegalus (gray bichir): 120542459 Help Entry 120542459         CDS       T08668                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism psex  Polypterus senegalus (gray bichir) Pathway psex03030   DNA replication psex03082   ATP-dependent chromatin remodeling psex03410   Base excision repair psex03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:psex00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     120542459 (pole3)    03410 Base excision repair     120542459 (pole3)    03420 Nucleotide excision repair     120542459 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120542459 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:psex03032]     120542459 (pole3)    03036 Chromosome and associated proteins [BR:psex03036]     120542459 (pole3)    03400 DNA repair and recombination proteins [BR:psex03400]     120542459 (pole3) Enzymes [BR:psex01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      120542459 (pole3) DNA replication proteins [BR:psex03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     120542459 (pole3) Chromosome and associated proteins [BR:psex03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     120542459 (pole3) DNA repair and recombination proteins [BR:psex03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       120542459 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone BUD22 RNA_pol_3_Rpc31 CENP-T_C CIS_TMP DUF4746 CDC45 Auts2 RR_TM4-6 DDHD Zip DUF5427 Motif Other DBs NCBI-GeneID:  120542459 NCBI-ProteinID:  XP_039630889 LinkDB All DBs Position 13:complement(3148632..3163256) Genome browser AA seq 153 aa AA seqDB search MAERPEDLNLPNAVVTRIIKEALPEGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLSAGDVLTAMEEMEFQRFLPPLREALEAYKKGQKGKKEASELKRKDKEKKSDVEDNE RSREEENEEEEEERMEEEQKEGDNDEDEEDMAN NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcggagagaccggaggacctgaacctgcccaacgcggtcgtcacgaggatcatcaag gaggcgcttcctgaaggtgtgaacatctccaaagaggcccgcagtgccatctcgagggcg gccagcgtctttgtcctttatgccacatcatgtgccaataactttgccatgaagggcaag aggaagaccctgagtgcaggggacgtcctgaccgccatggaggagatggagttccagaga ttcctcccaccattgagagaagccctagaagcgtacaaaaagggccagaagggtaagaag gaagcctcggagctgaagaggaaagacaaggaaaagaaaagcgacgtggaggacaacgag aggagccgtgaggaagagaacgaggaagaggaggaggagcgaatggaggaggagcagaag gagggagacaatgacgaggacgaggaggacatggccaactga

DBGET integrated database retrieval system