Pseudovibrio sp. FO-BEG1: PSE_0010
Help
Entry
PSE_0010 CDS
T01669
Name
(GenBank) aspartate kinase
KO
K00928
aspartate kinase [EC:
2.7.2.4
]
Organism
psf
Pseudovibrio sp. FO-BEG1
Pathway
psf00260
Glycine, serine and threonine metabolism
psf00261
Monobactam biosynthesis
psf00270
Cysteine and methionine metabolism
psf00300
Lysine biosynthesis
psf01100
Metabolic pathways
psf01110
Biosynthesis of secondary metabolites
psf01120
Microbial metabolism in diverse environments
psf01210
2-Oxocarboxylic acid metabolism
psf01230
Biosynthesis of amino acids
Module
psf_M00016
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
psf_M00018
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:
psf00001
]
09100 Metabolism
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
PSE_0010
00270 Cysteine and methionine metabolism
PSE_0010
00300 Lysine biosynthesis
PSE_0010
09110 Biosynthesis of other secondary metabolites
00261 Monobactam biosynthesis
PSE_0010
Enzymes [BR:
psf01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.2 Phosphotransferases with a carboxy group as acceptor
2.7.2.4 aspartate kinase
PSE_0010
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AA_kinase
ACT_9
ACT_7
ACT
ACT_AHAS_ss
Motif
Other DBs
NCBI-ProteinID:
AEV34522
LinkDB
All DBs
Position
complement(12848..14083)
Genome browser
AA seq
411 aa
AA seq
DB search
MKFGGTSVADLERIRNVARHVKREVEAGNQVAVVVSAMAGVTNTLVGYTKEAAALHDARE
YDAVVASGEQVTSGLLAIVLQDMGVDARSWQGWQIPIRTNEAHGAARIESIEGQTLIERL
ERGQVAVCAGFQGVAPDNRLATLGRGGSDTSAVAIAAAIQADRCDIYTDVDGVYTTDPRV
VAKATRLERVAFEEMLEMASLGAKVLQVRSVEMAMVHGVRTFVRSSFDDPDAPQISADGT
PVGTLICDEDEILEQQVVTGIAYSKDEAQISIRNVADKPGIASRVFGPLAEGNINVDMIV
QNISPDGKTTDITFTVPESDYERARKVIEENVEEIGFENIEGATDVVKVSVIGMGMRSHA
GVAAQCFEGLAEKGINIRAITTSEIKISVLIDSAYTELAVRTLHSLYGLDG
NT seq
1236 nt
NT seq
+upstream
nt +downstream
nt
atgaagtttggcggcacctccgttgccgacctagagcgtatcagaaatgttgcgcggcac
gtgaagcgtgaagtggaagcaggcaaccaggttgccgttgttgtatccgcgatggctggt
gtgacgaacacgctggttggctacacgaaagaagccgcagcgctgcatgatgcgcgtgaa
tatgatgcggttgttgcctcaggtgagcaggtgacttccggcttgttggcgattgtgctg
caagatatgggcgtggatgcacgttcctggcagggatggcagattcctatccgcacgaat
gaagcccacggcgcagcgcgcattgagagtattgaaggtcaaactctcattgaacgcctt
gagcgtggacaggttgcagtttgcgctggtttccagggtgtagcgcctgacaacaggctg
gcgacgcttggacgtggtggctctgacaccagtgcggtggcgattgctgctgctattcag
gcagatcgctgtgacatctatacggatgtggacggtgtttataccactgacccgcgtgtg
gtggccaaggcgacgcgtctggaacgtgttgcatttgaagagatgctggaaatggcttct
cttggtgcaaaggttttgcaggtccgttctgttgagatggcgatggttcacggcgttcgt
acgtttgtacgttccagctttgatgatccggatgccccgcagattagcgctgacggaaca
cctgtaggtacacttatttgcgacgaggacgagattttggaacaacaagtcgtcactggc
atcgcttactcaaaagacgaagcacagatttctatccgcaacgttgctgacaaacctggc
atcgcgtccagagtgtttggcccgttggccgaaggcaacatcaacgtagacatgatcgtt
cagaacatctctccagatgggaagacgaccgatatcacctttaccgttccagagagcgat
tacgagcgtgcgcgcaaggtaattgaggagaacgtcgaggaaattggcttcgagaatatc
gaaggcgctactgatgttgtaaaagtttccgtaatcggcatgggtatgcgttcgcatgcc
ggtgttgcagcccagtgttttgaaggcttggctgagaaggggattaacatccgcgcgatt
acgacatctgagattaaaatctctgttctgatcgattccgcgtatacggaacttgcggtt
cgtactctccattcgctatacggacttgacggctag
DBGET
integrated database retrieval system