Pseudovibrio sp. FO-BEG1: PSE_1491 Help Entry PSE_1491          CDS       T01669                                  Symbol groES Name (GenBank) 10 kDa chaperonin/GroES protein   KO K04078   chaperonin GroES Organism psf  Pseudovibrio sp. FO-BEG1 Brite KEGG Orthology (KO) [BR:psf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psf03110]     PSE_1491 (groES)    03029 Mitochondrial biogenesis [BR:psf03029]     PSE_1491 (groES) Chaperones and folding catalysts [BR:psf03110]  Heat shock proteins   HSP10    PSE_1491 (groES) Mitochondrial biogenesis [BR:psf03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     PSE_1491 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AEV36003 LinkDB All DBs Position complement(1578934..1579221) Genome browser AA seq 95 aa AA seqDB search MKFRPLHDRVVVRRIESEEKTAGGIIIPDTAKEKPQEGEVVAVGPGARKDNGELIAIDLK AGDRVLFGKWSGTEVKIDGEDLLIMKESDIMGVLA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaagtttcgtccgctacacgaccgtgttgtcgttcgccgtatcgagtctgaagaaaag actgctggtggcatcatcatccctgacactgcaaaagaaaagccacaggaaggcgaagta gttgcagtaggtcctggcgcacgcaaggacaacggtgagctgatcgctatcgaccttaaa gctggcgaccgcgttctgttcggcaaatggtccggtactgaagttaagatcgacggtgaa gacctgctgatcatgaaggaatccgacatcatgggcgttctggcttaa

DBGET integrated database retrieval system