Pseudarthrobacter sp. Fe7: NG819_04525 Help Entry NG819_04525       CDS       T10268                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism psfe  Pseudarthrobacter sp. Fe7 Brite KEGG Orthology (KO) [BR:psfe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:psfe03032]     NG819_04525    03036 Chromosome and associated proteins [BR:psfe03036]     NG819_04525    03400 DNA repair and recombination proteins [BR:psfe03400]     NG819_04525 DNA replication proteins [BR:psfe03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NG819_04525 Chromosome and associated proteins [BR:psfe03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     NG819_04525 DNA repair and recombination proteins [BR:psfe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       NG819_04525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF7342 Motif Other DBs NCBI-ProteinID:  UUL76942 UniProt:  A0AAT9QKU5 LinkDB All DBs Position 889221..889505 Genome browser AA seq 94 aa AA seqDB search MAKNRSELVAEVAGKAGTSQAAVNSVLDALFEVFETSVAAGEKITIPGWLAVERTDRAAR TGRNPQTGETIQIAAGHSVKLTAGSKLKAAVSKK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctaagaaccgtagtgaacttgttgcagaggtagctggcaaggccggcaccagccag gctgccgtcaactccgtcctcgacgcactgttcgaggttttcgagacttctgtcgccgcc ggcgagaagatcaccatcccgggctggctcgccgtcgagcgcaccgaccgtgcagcacgc accggccgcaacccccagacgggcgagactatccagattgcagcaggccacagcgtcaag ctgaccgccggctccaagctgaaggctgcagtctccaagaagtag

DBGET integrated database retrieval system