Pseudarthrobacter sp. Fe7: NG819_08090 Help Entry NG819_08090       CDS       T10268                                  Name (GenBank) hypothetical protein   KO K06153   undecaprenyl-diphosphatase [EC:3.6.1.27] Organism psfe  Pseudarthrobacter sp. Fe7 Pathway psfe00550   Peptidoglycan biosynthesis psfe00552   Teichoic acid biosynthesis Brite KEGG Orthology (KO) [BR:psfe00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00550 Peptidoglycan biosynthesis     NG819_08090    00552 Teichoic acid biosynthesis     NG819_08090  09180 Brite Hierarchies   09181 Protein families: metabolism    01011 Peptidoglycan biosynthesis and degradation proteins [BR:psfe01011]     NG819_08090 Enzymes [BR:psfe01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.27  undecaprenyl-diphosphate phosphatase      NG819_08090 Peptidoglycan biosynthesis and degradation proteins [BR:psfe01011]  Precursor biosynthesis   Diphosphatase    NG819_08090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BacA Motif Other DBs NCBI-ProteinID:  UUL77415 UniProt:  A0AAT9QNK9 LinkDB All DBs Position complement(1602384..1602557) Genome browser AA seq 57 aa AA seqDB search MADQRGVFLVGALCSAVAAWFATRFLLRFFETRTLTPFAIYCVVGGGIYFVAMLVMG NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagcggggcgttttcctcgtcggagccctttgctccgccgtcgccgcctgg ttcgcaaccaggttcctcctcaggttcttcgagaccagaaccctgactccattcgccatc tactgcgtggttggcggcggcatctacttcgtggccatgctggtcatgggataa

DBGET integrated database retrieval system