Pseudocitrobacter corydidari: G163CM_13840
Help
Entry
G163CM_13840 CDS
T07750
Symbol
yqiK
Name
(GenBank) Inner membrane protein YqiK
KO
K07192
flotillin
Organism
psgc
Pseudocitrobacter corydidari
Brite
KEGG Orthology (KO) [BR:
psgc00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
psgc04131
]
G163CM_13840 (yqiK)
03036 Chromosome and associated proteins [BR:
psgc03036
]
G163CM_13840 (yqiK)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
psgc04147
]
G163CM_13840 (yqiK)
Membrane trafficking [BR:
psgc04131
]
Endocytosis
Lipid raft mediated endocytosis
Flotillin-dependent endocytosis
G163CM_13840 (yqiK)
Chromosome and associated proteins [BR:
psgc03036
]
Eukaryotic type
Centrosome formation proteins
Other centrosome associated proteins
G163CM_13840 (yqiK)
Exosome [BR:
psgc04147
]
Exosomal proteins
Proteins found in most exosomes
G163CM_13840 (yqiK)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Flot
Band_7
Band_7_1
DUF997
Motif
Other DBs
NCBI-ProteinID:
UGS40685
UniProt:
A0ABY3S1X8
LinkDB
All DBs
Position
1508660..1510354
Genome browser
AA seq
564 aa
AA seq
DB search
MDDVIGMLPSWMFTAIIAVFILLVVGIIFARLYRRASAEQSFVRTGLGGQKVVMSGGAIV
MPIFHEIIPINMNTLKLEVSRSTVDSLITKDRMRVDVVVAFFVRVKPTVEGIATAAQTLG
QRTLSPEDLRVLIEDKFVDALRATASQMTMHELQDTRENFVQGVQNTVAEDLSKNGLELE
SVSLTNFNQTEKVHFNPNNAFDAEGLTKLTQETERRRRERNEVEQDVEIAVREKNRDALS
RKLEIEQQEAFMTLEQEQQVKTRTAEQNAKIAAFEAERHREAEQTRILAERQIQEAEIER
EQAVRSRKVEAEREVRIKEIEQQQVTEIANQTKSIAIAAKSEQQSQAEARANDALAEAVR
SQQNVETTRQTAEADRAKQVALIAAAQDAETQAVELTVRAKAEKEAAEMQAAAIVELAEA
TRKKGLAEAEAQRALNDAINVLSDEQTSLKFKLALLQSLPSVIEKSVEPMKSIDGIKIIQ
VDGLNRGGITGEATSGVANGGNLAEQALSAALSYRTQAPLIDSLLKEIGLSGGSLSALAE
PLKSDAISEKPSTVNPVEMRAESE
NT seq
1695 nt
NT seq
+upstream
nt +downstream
nt
atggatgatgttattggcatgctgccatcatggatgtttaccgccatcatcgcggttttc
attttgttggttgttgggattattttcgccaggttatatcgtcgggcttccgccgaacaa
tcctttgttcgaacgggactgggcgggcaaaaagtggtgatgagtggtggcgcaattgtc
atgcccatcttccacgaaatcattcctatcaacatgaataccctaaaactggaagtcagc
cgttcaaccgtcgatagcctgatcacaaaagatcgtatgcgtgtcgatgtcgtcgtggcc
ttctttgtacgggtcaagcctaccgtggaaggaattgcaaccgctgcgcaaaccctcggg
cagcgaaccctttcaccggaagatttacgtgtgctcattgaagataaattcgtggatgcc
ctgcgtgctaccgcctcgcaaatgaccatgcatgaacttcaggatacgcgagaaaacttt
gtacagggtgtacaaaatacggttgcagaagatctgtcaaagaacggactggagctagaa
agcgtctcgttaaccaattttaaccagacagaaaaagtacatttcaacccaaacaacgcc
tttgatgccgaaggcctgacaaaactgacgcaggaaacggaacgccgtcgtcgtgaacgt
aacgaagttgagcaagatgtggaaattgccgttcgcgagaaaaaccgtgatgcactgtcg
cgcaagctggagattgaacagcaggaagcgttcatgacgcttgagcaggaacaacaagtg
aaaacgcgtactgccgagcagaatgcaaaaattgccgcttttgaagccgagcgtcaccgt
gaagctgaacaaacgcgcattcttgccgagcgccaaattcaggaagcagaaatcgagcgt
gaacaggcagtacgttcccgtaaagtggaagccgagcgtgaagttcgcataaaagaaatt
gaacagcagcaggtcaccgaaattgctaaccagaccaaatctattgccattgcggcgaag
tctgaacagcaatcccaggcagaagcccgcgctaacgatgcgctggcagaagccgttcgc
tcgcagcagaacgttgagaccacgcgccagaccgcagaagctgatcgtgcgaaacaagtt
gcactgatcgctgccgcacaggatgcagaaacccaggcggttgaactgaccgtgcgggca
aaagcagagaaagaagcagcggaaatgcaggcggcagcgattgttgaacttgccgaagca
acgcgtaaaaaaggccttgccgaggcggaagcgcaacgcgcgctgaacgacgccattaac
gtactttctgatgaacaaactagcctgaaattcaaactggccctgttgcagtcgctgccg
tctgtgattgagaaatccgttgaaccaatgaagtctatcgacggcattaagataatccag
gtcgatgggttgaatcgtggcggcatcaccggtgaagctacctcgggcgttgcaaacggc
ggtaatctggcagaacaggccctgtcagctgcgctctcttaccgcactcaggcaccgctg
attgattcactgttgaaagagatcggtctgtccggaggttcactatccgcattagcggaa
ccgttaaaatcggatgctataagcgagaaaccgtctacggttaacccggtggaaatgcga
gctgaaagcgagtaa
DBGET
integrated database retrieval system