Pseudocitrobacter corydidari: G163CM_31230 Help Entry G163CM_31230      CDS       T07750                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism psgc  Pseudocitrobacter corydidari Pathway psgc02024   Quorum sensing psgc03018   RNA degradation Brite KEGG Orthology (KO) [BR:psgc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     G163CM_31230 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     G163CM_31230 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psgc03019]     G163CM_31230 (hfq)    03036 Chromosome and associated proteins [BR:psgc03036]     G163CM_31230 (hfq) Messenger RNA biogenesis [BR:psgc03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      G163CM_31230 (hfq) Chromosome and associated proteins [BR:psgc03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     G163CM_31230 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Herpes_capsid Motif Other DBs NCBI-ProteinID:  UGS42394 UniProt:  A0ABY3S8H5 LinkDB All DBs Position complement(3349039..3349350) Genome browser AA seq 103 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGTSSNYHHGSNAQGSTTAQQDSDDTE NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagacccgttcctgaacgcactacgtcgggagcgtgtt ccggtttctatttatttggtgaatggtattaagctgcaaggtcaaattgagtccttcgac cagttcgtgatcctgttgaaaaacacggtcagccagatggtctataagcacgcaatttcc actgttgttccgtcccgtccggtatctcatcacagcaataacgctggcggcggcaccagc agtaactaccatcatggtagcaacgcgcagggttcaaccactgcgcagcaagacagcgac gacacagaataa

DBGET integrated database retrieval system