Pseudocitrobacter corydidari: G163CM_31830 Help Entry G163CM_31830      CDS       T07750                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism psgc  Pseudocitrobacter corydidari Pathway psgc01100   Metabolic pathways psgc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psgc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G163CM_31830 (acpP_2)    00074 Mycolic acid biosynthesis     G163CM_31830 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G163CM_31830 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding MCM_WH_arc DUF1493 DUF1015 Nup192 Motif Other DBs NCBI-ProteinID:  UGS42446 LinkDB All DBs Position 3428074..3428334 Genome browser AA seq 86 aa AA seqDB search MVNRERVMDYILSCLREMIEKGLEIKPDSDLVNDLGLESIKVMDLLMELEDEFDISIPIN ILLDVRTPAQLRDALIPFLENRNEPV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaagagtgatggattacattctctcctgcttgcgggagatgatcgaa aagggactggaaatcaagcctgacagtgacctcgtcaacgatctgggcctggagtcgata aaggtgatggatttattgatggagcttgaagatgaattcgatatttccatacctatcaac atcttgctggatgtcagaacgcctgcgcaattgcgcgacgccttaattcctttcctggag aaccgcaatgagcctgtatga

DBGET integrated database retrieval system