Pseudocitrobacter corydidari: G163CM_37220 Help Entry G163CM_37220      CDS       T07750                                  Symbol grxC Name (GenBank) Glutaredoxin 3   KO K03676   glutaredoxin 3 Organism psgc  Pseudocitrobacter corydidari Brite KEGG Orthology (KO) [BR:psgc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psgc03110]     G163CM_37220 (grxC) Chaperones and folding catalysts [BR:psgc03110]  Protein folding catalysts   Protein disulfide isomerase    G163CM_37220 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR GST_N CLIC-like_N Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  UGS42958 LinkDB All DBs Position 4014336..4014584 Genome browser AA seq 82 aa AA seqDB search MATIEIYTKATCPFCHRAKALLSSKGVTFQELPIDGDAEKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDARGGLDPLL NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctactatcgaaatctacaccaaagcgacctgcccgttttgccatcgcgcaaaagca ttgctgagcagcaaaggcgttaccttccaggagctgccgatcgatggcgacgcggaaaaa cgcgaagagatgattaagcgcagtggccgcacgacggttccgcagatttttattgatgca cagcacattggcggctgtgatgacttgtatgcgcttgatgcacgtggtggacttgatccc ctgctgtaa

DBGET integrated database retrieval system