Pseudocitrobacter corydidari: G163CM_44840 Help Entry G163CM_44840      CDS       T07750                                  Symbol acpP_3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism psgc  Pseudocitrobacter corydidari Pathway psgc01100   Metabolic pathways psgc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psgc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G163CM_44840 (acpP_3)    00074 Mycolic acid biosynthesis     G163CM_44840 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G163CM_44840 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GshA Motif Other DBs NCBI-ProteinID:  UGS43704 LinkDB All DBs Position complement(4804814..4805065) Genome browser AA seq 83 aa AA seqDB search MTDQTAVYQEVTSLLVKLFEVDPAAITPEARLYEDLELDSIDAVDMIVQLQKKTGKKIKP EEFKAVRTVQDVVDAVERLLREA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccgaccaaactgctgtctatcaggaagtcacttccctgctggtaaaactgttcgaa gtagacccggcggccatcacccccgaggcgcgtctgtatgaagatcttgaactcgatagc attgatgctgtggatatgatcgtccagttgcagaaaaagaccggcaagaaaattaagccg gaagagttcaaagccgtgcgcaccgtgcaggatgtggttgacgccgtcgagcgcctgctg cgggaagcctga

DBGET integrated database retrieval system