Stutzerimonas stutzeri RCH2: Psest_1689 Help Entry Psest_1689        CDS       T02391                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psh  Stutzerimonas stutzeri RCH2 Pathway psh01100   Metabolic pathways psh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Psest_1689    00074 Mycolic acid biosynthesis     Psest_1689   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Psest_1689 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 HLH NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AGA86239 UniProt:  L0GLN3 LinkDB All DBs Position 1797273..1797509 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgccgagcaacttggcgttaaagaa gaggaagtaaccaacagcgcttccttcgtcgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgagatcccggacgagcaggct gagaagatcaccaccgttcaggaagccatcgattacatcaatgcgcacgcgcagtaa

DBGET integrated database retrieval system