KEGG   Pseudomonas shahriarae: HU773_000695
Entry
HU773_000695      CDS       T07642                                 
Symbol
uvrD
Name
(GenBank) DNA helicase II
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
pshh  Pseudomonas shahriarae
Pathway
pshh03420  Nucleotide excision repair
pshh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pshh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    HU773_000695 (uvrD)
   03430 Mismatch repair
    HU773_000695 (uvrD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pshh03400]
    HU773_000695 (uvrD)
Enzymes [BR:pshh01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     HU773_000695 (uvrD)
DNA repair and recombination proteins [BR:pshh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     HU773_000695 (uvrD)
   MMR (mismatch excision repair)
    Other MMR factors
     HU773_000695 (uvrD)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 PcrA_UvrD_tudor AAA_11 AAA_22 Viral_helicase1 RHH_1
Other DBs
NCBI-ProteinID: QXH89433
LinkDB
Position
153114..155297
AA seq 727 aa
MRDDLSLLLNSLNDAQRQAVAAPVGRQLVLAGAGSGKTRVLVHRIAWLIQVENASPHSIL
SVTFTNKAAAEMRHRIEQLMGISPAGMWVGTFHGLAHRLLRAHWQEAGLAQTFQILDSDD
QQRLVKRVIRELGLDEQRWPVRQAQWFINGQKDEGLRPQHIQASGDLFLATMRSIYEAYE
VACQRAGVIDFSELLLRALDLWRDNPGLLAHYQKRFRHILVDEFQDTNAVQYAWLRLLAK
GGDSLMVVGDDDQSIYGWRGAKIENIYQYSDDFPDAETIRLEQNYRSTAGILKAANALIA
NNTGRLGKELWTDGGEGEAINLYAAFNEHDEARYVVETIESALKTGLARSDIAILYRSNA
QSRVLEEALLRERIPYRIYGGQRFFERAEIKNAMAYLRLLEGRGNDAALERVINVPARGI
GEKTVEAIREHARHSDVSMWEAMRLLIANKGLTGRAAGALGGFVELIDSLAAKCLEMPLH
LMTQTVIEQSGLIAYHEAEKGEKGQARVENLEELVSAARAFENSEEDADLSPLAAFLGHA
SLEAGDTQADEHEDSVQLMTLHSAKGLEFPYVFLVGMEEGLFPHKMSLEEPGRLEEERRL
AYVGITRAMQNLVMTYAETRRLYGSETYNKVSRFVREVPKGLIQEVRLSNSVSRPFGGGQ
QQNSSSMFAGSEIPETPFSLGQQVRHAIFGEGVILNFEGAGAQARVQVNFAEGSKWLMMG
YAKLEAV
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgcgcgatgatctctcccttttgctgaactccctcaacgatgcccaacgccaggccgta
gcagcccccgttggccgtcagttggtcctggccggtgctggctccggtaaaacccgcgtg
ctggtgcaccgtatcgcctggttgatccaggtcgagaacgcgtccccgcattcgatcctg
tcggtgaccttcaccaacaaggccgctgccgagatgcgccaccgcatcgagcagttgatg
ggcatcagcccggccgggatgtgggtcggcaccttccacggcctggcgcaccgcctgttg
cgggcccactggcaggaggcgggcctggcccagaccttccagattctcgacagcgatgac
cagcaacgcctggtcaagcgggtaatccgcgagttgggcctggatgaacaacgctggccg
gtccgccaggcccagtggtttatcaacggccagaaagacgaaggcctgcgcccgcaacat
atccaggccagtggcgacctgttcctggccaccatgcgcagcatttatgaagcctatgaa
gtggcctgccagcgagccggcgtcatcgacttctccgaactgctgctgcgcgccctcgac
ctgtggcgtgacaaccccggtttgctcgcgcactaccagaagcgcttccggcacatcctg
gtggacgagttccaggacaccaacgccgtgcagtacgcctggttgcgcctgctggccaag
ggcggcgacagcctgatggtggtgggcgacgacgaccagtcgatctacggctggcgcggc
gcgaaaatcgagaacatctaccagtactccgacgacttccccgacgccgagactattcgc
ctggagcagaactatcgctccaccgccgggatcctcaaggccgccaacgccttgatcgcc
aataacaccgggcgcctgggcaaggagttgtggaccgatggcggcgaaggcgaggcgatc
aacctctacgccgccttcaacgagcacgacgaagcgcgctatgtggtcgaaaccattgaa
agcgccctgaaaaccgggctggcccgcagcgatatcgctattttgtaccgttccaacgcc
caatcgcgggtgttggaagaagccttgctgcgcgagcgcatcccgtatcgcatctatggc
ggccaacgcttcttcgagcgtgcggaaatcaagaacgccatggcctacctgcgtttgctg
gaaggccgcggcaacgatgcagcgctggagcgggtgatcaacgtaccggcacggggcatc
ggcgagaaaaccgtcgaggcgatccgcgagcatgcgcgtcacagcgatgtgtcgatgtgg
gaggccatgcgcctgctgatcgccaataaaggcctgaccggccgcgctgccggggctttg
ggtgggtttgtcgagttgatcgacagcctcgccgccaagtgcctggaaatgccgctgcac
ctgatgacccagaccgtgatcgaacagtccggcctgattgcttatcacgaagcggaaaaa
ggcgagaaaggccaggcccgggtagaaaaccttgaggaactggtcagcgccgcccgcgcg
ttcgagaacagtgaggaagatgccgacctgtcgccattggcggcgttcctcggccatgcc
tccctggaagcgggcgatacccaggccgacgagcacgaagacagcgtgcagttgatgacc
ctgcacagtgccaagggcctggaattcccctacgtgttcctggtgggcatggaagaaggc
ctgttcccgcacaagatgagcctggaagagcccggccgccttgaggaagaacgccgcctg
gcctacgtgggtatcacccgggcgatgcagaacctggtgatgacctacgccgagacacgg
cgcctgtatggcagcgaaacctacaacaaggtctcgcgtttcgtacgggaagtgccgaaa
gggctgattcaggaagtgcgcttgtccaatagcgtcagccggccgtttggcggcggccag
cagcagaactccagcagcatgtttgccggttcggaaattcccgagaccccgttcagcctt
ggccagcaggtcaggcatgcgatctttggcgaaggggtgatcctcaacttcgaaggcgcc
ggggcccaggcccgagtgcaggtgaacttcgccgaaggcagcaagtggttgatgatgggt
tacgccaagctcgaagcggtctga

DBGET integrated database retrieval system