Pseudomonas shahriarae: HU773_002405 Help Entry HU773_002405      CDS       T07642                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pshh  Pseudomonas shahriarae Brite KEGG Orthology (KO) [BR:pshh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pshh03110]     HU773_002405 (grxC) Chaperones and folding catalysts [BR:pshh03110]  Protein folding catalysts   Protein disulfide isomerase    HU773_002405 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 DSBA Glrx-like SH3BGR Thioredoxin_4 GST_N Motif Other DBs NCBI-ProteinID:  QXH89748 LinkDB All DBs Position 535244..535498 Genome browser AA seq 84 aa AA seqDB search MSQVVVYSSDYCPYCMRAKQLLQSKKVAFEEIKVDGKPAVRAEMAQKAGRTSVPQIWIGT QHIGGCDDLFALERAGKLDALLHV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagccaggttgtcgtttattccagcgattattgcccctattgcatgcgagccaagcag ttgctccagagcaaaaaggttgccttcgaagagatcaaggtcgatggcaagcctgcggtg cgtgccgagatggcccagaaggcggggcgcacctctgtgccgcaaatctggatcggtacc cagcatatcggtggatgcgacgacctgttcgccctggagcgcgccggtaaactcgacgcg ctgcttcacgtctga

DBGET integrated database retrieval system