Pseudomonas shahriarae: HU773_002905 Help Entry HU773_002905      CDS       T07642                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pshh  Pseudomonas shahriarae Pathway pshh01100   Metabolic pathways pshh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pshh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HU773_002905    00074 Mycolic acid biosynthesis     HU773_002905   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HU773_002905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QXH89843 LinkDB All DBs Position complement(648972..649241) Genome browser AA seq 89 aa AA seqDB search MSNPNSLEHEIKTLIIEALGLEDIDACDIGSEQPLFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFINVASLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccaaacagccttgagcacgaaatcaaaaccctgatcatcgaggccctgggc ctggaagatatcgacgcctgcgacattggcagcgagcaacccctgttcggcgaaggcctg ggcctggattcggtagacgccctggaactgggcctggcgatccagaaaaagtacggcatc aagatcgacgccgacgccaaggacacccgcaatcactttatcaacgtggccagcctcgcg gcgttcgtcacggccagacaggcagcttga

DBGET integrated database retrieval system