Pseudooceanicola spongiae: F3W81_04305 Help Entry F3W81_04305       CDS       T06866                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pshq  Pseudooceanicola spongiae Pathway pshq01100   Metabolic pathways pshq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pshq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F3W81_04305    00074 Mycolic acid biosynthesis     F3W81_04305   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F3W81_04305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QOL80114 UniProt:  A0A7L9WJU9 LinkDB All DBs Position 922058..922321 Genome browser AA seq 87 aa AA seqDB search MTDIKDKVIAIIAEQAVLEPADVSMDNTLEDVGIDSLGLVECIFAIEEAFDIQVPFNANE PNQSDFDISTIASIIAGVEKLVAEQHA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacggatatcaaggacaaggtgatcgcaatcatcgcggaacaagcggtgcttgagccc gccgacgtgtcgatggacaacaccctggaagacgtcggcatcgatagcctcgggctggtc gagtgcatctttgccattgaagaggcctttgatattcaggtgcccttcaacgccaatgag ccgaaccagagcgactttgacatctcgaccattgcctcgatcatcgcgggcgtcgaaaaa ctggtggcggaacaacacgcgtga

DBGET integrated database retrieval system