Pseudooceanicola spongiae: F3W81_06145 Help Entry F3W81_06145       CDS       T06866                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pshq  Pseudooceanicola spongiae Brite KEGG Orthology (KO) [BR:pshq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pshq03032]     F3W81_06145    03036 Chromosome and associated proteins [BR:pshq03036]     F3W81_06145    03400 DNA repair and recombination proteins [BR:pshq03400]     F3W81_06145 DNA replication proteins [BR:pshq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     F3W81_06145 Chromosome and associated proteins [BR:pshq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     F3W81_06145 DNA repair and recombination proteins [BR:pshq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       F3W81_06145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  QOL80429 UniProt:  A0A7L9WJM6 LinkDB All DBs Position complement(1305334..1305606) Genome browser AA seq 90 aa AA seqDB search MANYTKKDLIRDLAAETVTFQATAQQIVDGVFNRISERSAAGDKVAIAGFGKFEVKTRAA RTGRNPATGDPVEIPEKRVMKFTPTKASIS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcaaactacaccaaaaaagaccttatccgtgacctcgccgccgagactgtcaccttt caggccaccgcgcagcagattgtggatggcgtgttcaaccggatttcggagcgttctgcc gctggcgacaaggtggcgatcgcaggcttcggtaagttcgaggtcaagacccgtgccgcc cgcaccgggcgcaacccggccaccggtgatcccgtcgagatccccgaaaagcgggtgatg aaattcaccccgaccaaagcctcaatctcctga

DBGET integrated database retrieval system