Providencia stuartii MRSN 2154: S70_09725 Help Entry S70_09725         CDS       T02042                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism psi  Providencia stuartii MRSN 2154 Pathway psi01100   Metabolic pathways psi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     S70_09725    00074 Mycolic acid biosynthesis     S70_09725   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     S70_09725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFH93805 UniProt:  A0A140NL23 LinkDB All DBs Position complement(2087990..2088244) Genome browser AA seq 84 aa AA seqDB search MSTDNLIHQTWLTEQIKAIRAYSGIHKPITMDSTLILDLHIDSLEMLELITAIEDYTGQR LNDNIWVKWHRLQDIVDYLSQTKT NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagtacagataatttaattcatcaaacatggctgacggagcaaataaaagcgatccgt gcctattcggggatccataaacccattacgatggattcgaccttaattttagatttacat attgattcattggaaatgcttgagctaatcaccgccattgaagattacactggccaacga ttaaacgataatatctgggtaaaatggcatcgattacaggatattgttgattacctttct caaacgaagacctga

DBGET integrated database retrieval system