Providencia stuartii MRSN 2154: S70_15790 Help Entry S70_15790         CDS       T02042                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism psi  Providencia stuartii MRSN 2154 Pathway psi00190   Oxidative phosphorylation psi01100   Metabolic pathways psi02020   Two-component system Module psi_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:psi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     S70_15790  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     S70_15790 Enzymes [BR:psi01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      S70_15790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AFH94973 UniProt:  A0A140NQ33 LinkDB All DBs Position 3357103..3357216 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFAVIAALALEHAEDKAAAKDGE NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggattcttggcacgctgttagcttgtagttttgcagtgattgca gctctagctttagagcatgcggaagataaagctgctgctaaagatggcgagtaa

DBGET integrated database retrieval system